PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009590483.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family HD-ZIP
Protein Properties Length: 210aa    MW: 24265.3 Da    PI: 5.8434
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009590483.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox62.75.3e-2052104456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     ++++++eq++ Le+ F +++++  e++ +LA++lgL+ rqV vWFqNrRa++k
  XP_009590483.1  52 KRKLSDEQVNLLEQSFGNEHKLESERKDKLASELGLDPRQVAVWFQNRRARWK 104
                     45899***********************************************9 PP

2HD-ZIP_I/II121.73.7e-3951142293
     HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                     +kr+ls+eqv+lLE+sF +e+kLe+erK +la+eLgl+prqvavWFqnrRAR+k+k+lE++y++Lk+ +d+ + e++rLe+ev +L+++l+e
  XP_009590483.1  51 RKRKLSDEQVNLLEQSFGNEHKLESERKDKLASELGLDPRQVAVWFQNRRARWKSKKLEEEYSKLKSDHDTNVVEKCRLESEVLKLKDQLSE 142
                     8****************************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.03846106IPR001356Homeobox domain
SMARTSM003895.5E-1949110IPR001356Homeobox domain
CDDcd000867.82E-1751107No hitNo description
SuperFamilySSF466892.01E-1851116IPR009057Homeodomain-like
PfamPF000464.2E-1752104IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.5E-2153113IPR009057Homeodomain-like
PRINTSPR000318.4E-67786IPR000047Helix-turn-helix motif
PROSITE patternPS00027081104IPR017970Homeobox, conserved site
PRINTSPR000318.4E-686102IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 210 aa     Download sequence    Send to blast
MNHQVAADEM VLISQYYPDI YTQLVPQQGE SKPRRRRKKK QGEGSGSGVM RKRKLSDEQV  60
NLLEQSFGNE HKLESERKDK LASELGLDPR QVAVWFQNRR ARWKSKKLEE EYSKLKSDHD  120
TNVVEKCRLE SEVLKLKDQL SEAEKEIQRL LLERCDGVSS NNSPSTSSFS MEAAMEPPFL  180
GEFGMEGLDN VFYTPDNTYV QGLDWVNLYI
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13339RRRRKKK
23753KKKQGEGSGSGVMRKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009590483.11e-156PREDICTED: homeobox-leucine zipper protein ATHB-40
RefseqXP_016433151.11e-156PREDICTED: homeobox-leucine zipper protein ATHB-40-like
SwissprotQ9ZU702e-82ATB21_ARATH; Homeobox-leucine zipper protein ATHB-21
TrEMBLK4BB741e-117K4BB74_SOLLC; Uncharacterized protein
STRINGSolyc02g085630.2.11e-117(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12892480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G18550.19e-69homeobox protein 21